hDC-sign binding peptides

摘要: This invention concerns DC-SIGN binding peptides or proteins and uses thereof in modulating immune responses treating disorders. Accordingly, one aspect of this features an isolated protein containing a first polypeptide chain that has the sequence VWDVSHEDPHEVKFNWYVDGVEVHNAKTKPREQQYNSTY (SEQ ID NO: 1). The can be about 40 to 230 (e.g., 40-220, 40-200, 40-180, 15 40-150, 40-100, 40-80, 40-70, 40-60, 40-50, 40-45, inclusive) amino acid residues (aa.) length. just mentioned corresponds aa. 261-300 human lgG1 Fe. include additional fragment sequences from Fe, but optionally is not full-length IgGI