Identification of a Novel Linear B Cell Epitope on the Sao Protein of Streptococcus suis Serotype 2.
作者： Jing Wang , Ruirui Dong , Ping Zou , Yuejuan Chen , Na Li
关键词: Streptococcus suis serotype 2 、 Epitope 、 Microbiology 、 Antibody 、 Serotype 、 Streptococcus suis 、 Biology 、 B cell 、 Peptide 、 Antigen
摘要: Surface antigen one (Sao) protein is a bacterial surface identified in the important zoonotic pathogen Streptococcus suis serotype 2 (S. 2) during an extensive search for functional proteins. The Sao anchored to cell wall by LPVTG motif and widely distributed many S. serotypes. In this paper, we present immunodominant epitope peptide of that recognized BALB/c antibodies against protein: 355SEKQMPSVVNENAVTPEKQMTNKENDNIET384 (location Sao355-384). To determine core antibodies, prepared truncation libraries. Analyses immunoreactivity peptides with anti-Sao355-384 serum revealed most immunoreactive sequence was 355SEKQMPSVVNENAVTPEK372 Sao355-372). Moreover, observed also showed good specificity based on ratio reactivity from suis-positive patients compared suis-negative patients. Our results point potential using Sao355-372 diagnostic assays infection humans.
frontiersin.org
sci-hub.st 参考文章(20)
G. J. Xu, T. Kula, Q. Xu, M. Z. Li, S. D. Vernon, T. Ndung'u, K. Ruxrungtham, J. Sanchez, C. Brander, R. T. Chung, K. C. O'Connor, B. Walker, H. B. Larman, S. J. Elledge, Comprehensive serological profiling of human populations using a synthetic human virome Science. ,vol. 348, pp. 0698- ,(2015) , 10.1126/SCIENCE.AAA0698
Azza Abdelgawad, Robert Hermes, Armando Damiani, Benjamin Lamglait, Gábor Á. Czirják, Marion East, Ortwin Aschenborn, Christian Wenker, Samy Kasem, Nikolaus Osterrieder, Alex D. Greenwood, Comprehensive Serology Based on a Peptide ELISA to Assess the Prevalence of Closely Related Equine Herpesviruses in Zoo and Wild Animals. PLOS ONE. ,vol. 10, ,(2015) , 10.1371/JOURNAL.PONE.0138370
Youjun Feng, Feng Zheng, Xiuzhen Pan, Wen Sun, Changjun Wang, Yaqing Dong, Ai-ping Ju, Junchao Ge, Di Liu, Cuihua Liu, Jinghua Yan, Jiaqi Tang, George F. Gao, Existence and characterization of allelic variants of Sao, a newly identified surface protein from Streptococcus suis. Fems Microbiology Letters. ,vol. 275, pp. 80- 88 ,(2007) , 10.1111/J.1574-6968.2007.00859.X
J. Zhang, J. Zhu, H. Ren, S. Zhu, P. Zhao, F. Zhang, H. Lv, D. Hu, L. Hao, M. Geng, X. Gong, X. Pan, C. Wang, Z. Qi, Rapid Visual Detection of Highly Pathogenic Streptococcus suis Serotype 2 Isolates by Use of Loop-Mediated Isothermal Amplification Journal of Clinical Microbiology. ,vol. 51, pp. 3250- 3256 ,(2013) , 10.1128/JCM.01183-13
Guillaume Goyette-Desjardins, Jean-Philippe Auger, Jianguo Xu, Mariela Segura, Marcelo Gottschalk, Streptococcus suis, an important pig pathogen and emerging zoonotic agent-an update on the worldwide distribution based on serotyping and sequence typing. Emerging microbes & infections. ,vol. 3, pp. 1- 20 ,(2014) , 10.1038/EMI.2014.45
Yuanyi Li, Gabriela Martinez, Marcelo Gottschalk, Sonia Lacouture, Philip Willson, J. Daniel Dubreuil, Mario Jacques, Josee Harel, Identification of a surface protein of Streptococcus suis and evaluation of its immunogenic and protective capacity in pigs. Infection and Immunity. ,vol. 74, pp. 305- 312 ,(2006) , 10.1128/IAI.74.1.305-312.2006
Anusak Kerdsin, Surang Dejsirilert, Yukihiro Akeda, Tsutomu Sekizaki, Shigeyuki Hamada, Marcelo Gottschalk, Kazunori Oishi, Fifteen Streptococcus suis serotypes identified by multiplex PCR. Journal of Medical Microbiology. ,vol. 61, pp. 1669- 1672 ,(2012) , 10.1099/JMM.0.048587-0
Hongjie Yu, Huaiqi Jing, Zhihai Chen, Han Zheng, Xiaoping Zhu, Hua Wang, Shiwen Wang, Lunguang Liu, Rongqiang Zu, Longze Luo, Nijuan Xiang, Honglu Liu, Xuecheng Liu, Yuelong Shu, Shui Shan Lee, Shuk Kwan Chuang, Yu Wang, Jianguo Xu, Weizhong Yang, None, Human Streptococcus suis Outbreak, Sichuan, China Emerging Infectious Diseases. ,vol. 12, pp. 914- 920 ,(2006) , 10.3201/EID1206.051194
Velusamy Srinivasan, Lesley McGee, Berthe-Marie Njanpop-Lafourcade, Jennifer Moïsi, Bernard Beall, Species-specific real-time PCR assay for the detection of Streptococcus suis from clinical specimens. Diagnostic Microbiology and Infectious Disease. ,vol. 85, pp. 131- 132 ,(2016) , 10.1016/J.DIAGMICROBIO.2016.02.013
Nágilla D. Feliciano, Vanessa S. Ribeiro, Henrique T. Gonzaga, Fabiana A.A. Santos, Patricia T. Fujimura, Luiz R. Goulart, Julia M. Costa-Cruz, Short epitope-based synthetic peptides for serodiagnosis of human strongyloidiasis Immunology Letters. ,vol. 172, pp. 89- 93 ,(2016) , 10.1016/J.IMLET.2016.03.002