Identification of the Vasoconstriction-Inhibiting Factor (VIF), a Potent Endogenous Cofactor of Angiotensin II Acting on the Angiotensin II Type 2 Receptor
作者： Silvia Salem , Vera Jankowski , Yaw Asare , Elisa Liehn , Pia Welker
DOI: 10.1161/CIRCULATIONAHA.114.013168
关键词:
摘要: Background—The renin-angiotensin system and especially the angiotensin peptides play a central role in blood pressure regulation. Here, we hypothesize that an as-yet unknown peptide is involved action of II modulating vasoregulatory effects as cofactor. Methods Results—The with vasodilatory properties was isolated from adrenal glands chromatographically. The this were evaluated vitro vivo, receptor affinity analyzed. plasma concentration humans quantified patients chronic kidney disease, heart failure, healthy control subjects. amino acid sequence bovine HSSYEDELSEVL EKPNDQAE PKEVTEEVSSKDAAE, which degradation product chromogranin A. human HSGFEDELSEVLENQSSQAELKEAVEEPSSKDVME. Both diminished significantly vasoconstrictive effect vitro. Therefore, named t...
sci-hub.se 参考文章(40)
Robson A. S. Santos, Anderson J. Ferreira, Ana Cristina Simões e Silva, Recent advances in the angiotensin-converting enzyme 2-angiotensin(1-7)-Mas axis. Experimental Physiology. ,vol. 93, pp. 519- 527 ,(2008) , 10.1113/EXPPHYSIOL.2008.042002
Bruno Tota, Anna Maria Quintieri, Valentina Di Felice, Maria Carmela Cerra, New biological aspects of chromogranin A-derived peptides: focus on vasostatins. Comparative Biochemistry and Physiology A-molecular & Integrative Physiology. ,vol. 147, pp. 11- 18 ,(2007) , 10.1016/J.CBPA.2006.05.016
Vera Jankowski, Markus Tölle, Robson AS Santos, Thomas Günthner, Eberhard Krause, Michael Beyermann, Pia Welker, Michael Bader, Sergio Veloso Brant Pinheiro, Walkyria O Sampaio, Roberto Lautner, Axel Kretschmer, Markus van der Giet, Walter Zidek, Joachim Jankowski, None, Angioprotectin: an angiotensin II-like peptide causing vasodilatory effects The FASEB Journal. ,vol. 25, pp. 2987- 2995 ,(2011) , 10.1096/FJ.11-185470
J. George, A. D. Struthers, C. C. Lang, Modulation of the renin-angiotensin-aldosterone system in heart failure. Current Atherosclerosis Reports. ,vol. 16, pp. 403- ,(2014) , 10.1007/S11883-014-0403-7
Angelo Corti, Chromogranin A and the Tumor Microenvironment Cellular and Molecular Neurobiology. ,vol. 30, pp. 1163- 1170 ,(2010) , 10.1007/S10571-010-9587-8
Dinender Kumar, Vijayan Menon, William R. Ford, Alexander S. Clanachan, Bodh I. Jugdutt, Effect of angiotensin II type 2 receptor blockade on mitogen activated protein kinases during myocardial ischemia-reperfusion. Molecular and Cellular Biochemistry. ,vol. 258, pp. 211- 218 ,(2004) , 10.1023/B:MCBI.0000012857.06723.81
Carmine Savoia, Fatiha Tabet, Guoying Yao, Ernesto L Schiffrin, Rhian M Touyz, Negative regulation of RhoA/Rho kinase by angiotensin II type 2 receptor in vascular smooth muscle cells: role in angiotensin II-induced vasodilation in stroke-prone spontaneously hypertensive rats. Journal of Hypertension. ,vol. 23, pp. 1037- 1045 ,(2005) , 10.1097/01.HJH.0000166845.49850.39
Sara S. Roscioni, Hiddo J. Lambers Heerspink, Dick de Zeeuw, The effect of RAAS blockade on the progression of diabetic nephropathy Nature Reviews Nephrology. ,vol. 10, pp. 77- 87 ,(2014) , 10.1038/NRNEPH.2013.251
M. C. Cerra, L. Iuri, T. Angelone, A. Corti, B. Tota, Recombinant N-terminal fragments of chromogranin-A modulate cardiac function of the Langendorff-perfused rat heart. Basic Research in Cardiology. ,vol. 101, pp. 43- 52 ,(2006) , 10.1007/S00395-005-0547-2
Silvestro Roatta, Magda Passatore, Matteo Novello, Barbara Colombo, Eleonora Dondossola, Mazher Mohammed, Gianni Losano, Angelo Corti, Karen B. Helle, The chromogranin A- derived N-terminal peptide vasostatin-I: In vivo effects on cardiovascular variables in the rabbit. Regulatory Peptides. ,vol. 168, pp. 10- 20 ,(2011) , 10.1016/J.REGPEP.2011.02.015